SPR-116A SPR-116B SPR-116C
HSP65 Protein
Stressmarq Biosciences
DESCRIPTION
Mycobacterium bovis BCG Recombinant HSP65 Protein
DETAILS
- Nature: Recombinant
- Purity: >90%
- Target: HSP65
- Category: Protein
- Conjugate: No tag
- References: 1. Koll H., et al. (1992) Cell. 68: 1163-1175. 2. Thole J.E.R., et al. (1985) Infect. Immuno. 50: 800-806. 3. Thole J.E.R., et al., (1987) Infect. Immuno. 55: 1466-1475. 4. Shinnick T.M. Sweetser D., Thole J., van Embden J. and Young R.A. (1987) Infect. Immuno. 55: 1932-1935. 5. Van Eden W., et al. (1988) Nature 331: 171-178. 6. Cobelens P.M., et al. (2002) Rheumatology 41: 775-779.
- Applications: WB | SDS-PAGE | Functional Assay | ELISA
- Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Protein Size: ~65 kDa
- Purification: Multi-Step Purified
- Concentration: Lot/batch specific. See included datasheet.
- Protein Length: Full Length
- Research Areas: Cancer | Heat Shock
- Storage Buffer: 20mM Tris/HCl, pH 7.5, 0.45M NaCl, 10% glycerol, 5mM bMe
- Alternative Names: 60kDa chaperonin 2 Protein, Antigen A Protein, Cell wall protein A Protein, groEL Protein, GroEL2 Protein, GroL2 Protein, M. Tuberculosis cell wall protein A Protein, M. Tuberculosis HSP65 Protein, Protein Cpm60 2 Protein
- Cite This Product: Mycobacterium bovis BCG Recombinant HSP65 Protein (StressMarq Biosciences, Canada, Cat # SPR-116A)
- Expression System: E. coli
- Species Full Name: Mycobacterium bovis BCG
- Amino Acid Sequence: MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWG APTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREG LRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLI AEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYI LLVSSKVSTVKDLLPLLEKVIGAGKPLLIIAEDVEGEALSTLVVNKIRGTFKSVAVKA PGFGDRRKAMLQDMAILTGGQVISEEVGLTLENADLSLLGKARKVVVTKDETTIVEGA GDTDAIAGRVAQIRQEIENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKH RIEDAVRNAKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQ IAFNSGLEPGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSALQNAASIA GLFLTTEAVVADKPEKEKASVPGGGDMGGMDF
- Storage Temperature: -20ºC
- Shipping Temperature: Blue Ice or 4ºC
- Cellular Localization: Cytoplasm
- Scientific Background: HSP65 isolated from Mycobacterium bovis BCG, is a member of the HSP60 family of heat shock proteins (2, 3). HSP60s are mitochondrial chaperonins that are typically held responsible for the transportation and refolding of proteins from the cytoplasm into the mitochondrial matrix. In addition to its role as a heat shock protein, HSP60 functions as a chaperonin to assist in folding linear amino acid chains into their respective three-dimensional structure. HSP60s are a ubiquitous class of HSPs that specifically promote the folding and assembly of cellular polypeptides in an ATP-dependent manner (1). Specifically, sequence comparison of HSP65 from different mycobacterium strains showed that the protein sequence of M. bovis BCG is identical to that of M. tuberculosis, and very similar to that of M. leprae, the pathogens that cause tuberculosis and tuberculoid leprosy, respectively (2,4). Mycobacterium bovis BCG HSP65 was identified as the immunodominant antigen during mycobacterial diseases and vaccination. It is also believed to be the antigen that induces autoimmune disease, such as adjuvant arthritis in rats (5, 6).
- Certificate of Analysis: This product has been certified >90% pure using SDS-PAGE analysis.