SPR-481B SPR-481C SPR-481E
Alpha Synuclein Monomers
Stressmarq Biosciences
Image
![](https://www.stressmarq.com/wp-content/uploads/SPR-481_Alpha-Synuclein-Monomer-Protein-SDS-PAGE-1.png)
Image
![](https://www.stressmarq.com/wp-content/uploads/SPR-481_Alpha-Synuclein-Monomer-Protein-Thioflavin-T-assay-1.png)
DESCRIPTION
Rat Recombinant Alpha Synuclein Protein Monomers
DETAILS
- Nature: Recombinant
- Purity: >95%
- Target: Alpha Synuclein
- Category: Protein
- Conjugate: No Tag
- References: 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757. 7. Polymeropoulos, M. H. (1998). Science. 276(5321), 2045–2047 8. Conway, K.E., et al. (1998). Nat Med. 4(11):1318-20
- Applications: WB | SDS-PAGE | In vivo assay | In vitro assay
- Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Protein Size: 14.515 kDa
- Purification: Ion-exchange Purified
- Concentration: Lot/batch specific. See included datasheet.
- Protein Length: Full Length
- Research Areas: Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
- Storage Buffer: PBS pH 7.4
- Alternative Names: Alpha synuclein pre-formed fibrils, Alpha synuclein aggregates, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkison disease familial 1 Protein
- Cite This Product: Rat Recombinant Alpha Synuclein Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-481B)
- Expression System: E. coli
- Species Full Name: Rat
- Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
- Storage Temperature: -80ºC
- Shipping Temperature: Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
- Cellular Localization: Cytoplasm | Membrane | Nucleus
- Scientific Background: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6). The A53T mutation is a missense point mutation where alanine is replaced by threonine at the 53rd amino acid. This mutation has been linked to early-onset Parkinson's Disease and increased rates of alpha synuclein fibrillization.
- Certificate of Analysis: Certified >95% pure using SDS-PAGE analysis.
Equivalent Items
| ... Loading