Skip to Main Content
Welcome to the Scientist.com Marketplace

Go to Main Navigation

31112

BRPF1, His-tag Recombinant

BPS Bioscience

DETAILS

  • Aa: 2054-2168
  • Mw: 14.3 kDa
  • Tags: N-terminal His-tag
  • Format: Aqueous buffer solution
  • Genbank: NM_013450
  • Species: Human
  • Uniprot: P55201
  • Shiptemp: -80°C (dry ice)
  • Synonyms: Human Bromodomain and PHD finger containing 1, BRPF1
  • Warnings: Avoid freeze/thaw cycles.
  • Category: Bromodomain/Protein
  • References: 1. Laue, K., et al., Development. 2008 June; (135)111: 1935-46.2. Mayya, V., et al., Sci Signal. 2009 Aug 18; 2(84): ra46
  • Description: Human Bromodomain and PHD finger containing 1, also known as BRPF1, GenBank Accession No. NM_001003694, a.a. 627 - 746 corresponding to single bromodomain with N-terminal His-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
  • Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
  • Unspsc Code: 12352202
  • Unspsc Name: Proteins
  • Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
  • Host Species: E. coli
  • Product Type: Protein
  • Biosafety Level: Not applicable (BSL-1)
  • Storage Stability: At least 6 months at -80°C.
  • Amino Acid Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF EEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQAR RQAEKMG
  • Scientific Category: Bromodomain

DESCRIPTION

Human Bromodomain and PHD finger containing 1, also known as BRPF1, GenBank Accession No. NM_001003694, a.a. 627 - 746 corresponding to single bromodomain with N-terminal His-tag, MW = 15.1 kDa, expressed in an E. coli expression system.