Skip to Main Content
More Intelligent Procurement, Faster R&D

Go to Main Navigation

BLP-QP004

Scientist.com Supplier

Aquaporin 4/AQP4 (249-323) Blocking Peptide

Alomone Labs

DESCRIPTION:
Aquaporin 4/AQP4 (249-323) Blocking Peptide (#BLP-QP004) is the original antigen used for immunization during Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004) generation. The blocking peptide binds and ‘blocks’ Anti-Aquaporin 4/AQP4 (249-323) primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control. Aquaporin 4/AQP4 (249-323) Blocking Peptide (#BLP-QP004) is the original antigen used for immunization during Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004) generation. The blocking peptide binds and 'blocks' Anti-Aquaporin 4/AQP4 (249-323) primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

DETAILS

  • Form: Lyophilized powder
  • Type: GST fusion protein
  • Purity: >95% (SDS-PAGE)
  • Target: AQP4
  • Comment: Contact Alomone Labs for technical support and product customization
  • Gene Id: 25293
  • Sequence: GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4
  • Accession: P47863
  • Lead Time: 1-2 Business Days
  • Formulation: Lyophilized Powder.
  • Product Group: Blocking Peptide
  • Reconstitution: 100 μl PBS
  • Antibody Gene Id: 25293
  • Peptide Confirmation: Confirmed by DNA sequence and SDS-PAGE
  • Shipping And Storage: Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
  • Storage After Reconstitution: -20°C.
  • Antigen Preadsorption Control: 3 µg fusion protein per 1 µg antibody
  • Applications May Also Work In: WB|IHC
  • Storage Before Reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C
  • Concentration After Reconstitution: 1.2 mg/ml.
  • Standard Quality Control Of Each Lot: Western blot analysis.
  • Product Page Antibodies Part Of Immunogen: GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4