32-7027-10 32-7027
Recombinant Human IL-1 Receptor Antagonist Protein/IL-1RA/IL-1F3
Abeomics
Image
DESCRIPTION
Source: E.coli. MW :17.26kD. Recombinant Human Interleukin-1 Receptor Antagonist Protein is produced by our E.coli expression system and the target gene encoding Arg26-Glu177 is expressed. Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.
DETAILS
- Gene: IL1RN
- Gene Id: 3557
- Amino Acid: MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
- Uniprot Id: P18510
- Product Content: Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl, 200mM NaCl, pH 7.5.
- Application Note: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. Biological Activity : ED50 is 0.5 ng/ml. Specific Activity of 2.0 x 10^6 IU/mg.
- Storage Condition: Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
- Shipping Condition: The product is shipped at ambient temperature.