32-8839-10 32-8839-50
Scientist.com Supplier
Recombinant Human SLAM Family Member 6/SLAMF6/CD352/NTB-A (C-Fc)
Abeomics
DESCRIPTION
Source: Human Cells. MW :49.6kD. Recombinant Human SLAM Family Member 6 is produced by our Mammalian expression system and the target gene encoding Gln22-Lys225 is expressed with a Fc tag at the C-terminus. SLAM Family Member 6 (SLAMF6) is a single-pass type I membrane protein that belongs to the SLAM subgroup of the CD2 family. Human SLAMF6/ NTB-A contains a 205 amino acid extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain, a 21 amino acid transmembrane segment and an 84 amino acid cytoplasmic domain, with two immunoreceptor tyrosine-based switch motifs. SLAMF6 is a homodimer. SLAMF6 can interact with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. Phosphorylation-dependent NTB-A association with SAP is required for full production of IFN- gamma by NK cells and independent of EAT-2 binding. It Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. On B cells, NTB-A modulates immunoglobulin class switching and the balance between tolerance and autoimmunity.
DETAILS
- Gene: SLAMF6
- Gene Id: 114836
- Amino Acid: QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Uniprot Id: Q96DU3
- Product Content: Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
- Application Note: Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
- Categories Name 1: Recombinant Proteins
- Categories Name 2: Recombinant Proteins
- Storage Condition: Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
- Shipping Condition: The product is shipped on dry ice/ice packs.
Equivalent Items
| ... Loading