Skip to Main Content
More Intelligent Procurement, Faster R&D

Go to Main Navigation

32-8839-10 32-8839

Recombinant Human SLAM Family Member 6/SLAMF6/CD352/NTB-A (C-Fc)

Abeomics

DESCRIPTION

Source: Human Cells. MW :49.6kD. Recombinant Human SLAM Family Member 6 is produced by our Mammalian expression system and the target gene encoding Gln22-Lys225 is expressed with a Fc tag at the C-terminus. SLAM Family Member 6 (SLAMF6) is a single-pass type I membrane protein that belongs to the SLAM subgroup of the CD2 family. Human SLAMF6/ NTB-A contains a 205 amino acid extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain, a 21 amino acid transmembrane segment and an 84 amino acid cytoplasmic domain, with two immunoreceptor tyrosine-based switch motifs. SLAMF6 is a homodimer. SLAMF6 can interact with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. Phosphorylation-dependent NTB-A association with SAP is required for full production of IFN- gamma by NK cells and independent of EAT-2 binding. It Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. On B cells, NTB-A modulates immunoglobulin class switching and the balance between tolerance and autoimmunity.

DETAILS

  • Gene: SLAMF6
  • Gene Id: 114836
  • Amino Acid: QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Uniprot Id: Q96DU3
  • Product Content: Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Application Note: Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Storage Condition: Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
  • Shipping Condition: The product is shipped on dry ice/ice packs.