Skip to Main Content
Welcome to the Scientist.com Marketplace

Go to Main Navigation

32-7316-10 32-7316

Recombinant Human Protein FAM3D (C-6His)

Abeomics

DESCRIPTION

Source: Human Cells. MW :23.12kD. Recombinant Human Protein FAM3D is produced by our Mammalian expression system and the target gene encoding Tyr26-Phe224 is expressed with a 6His tag at the C-terminus. Protein FAM3D is a novel cytokine-like protein that belongs to the FAM3 family. Human FAM3D is synthesized as a 224 amino acid precursor that contains a 25 amino acid signal sequence and a 199 amino acid mature chain. FAM3D is identified based on structural, but not sequence, homology to short chain cytokines including IL-2, IL-4 and GM-CSF. FAM3 proteins are four helix bundle cytokines with four conserved cysteines in all members (FAM3A-D). FAM3B is highly expressed in alpha and beta cells of the pancreas and is being investigated as a potential contributor to beta cell death and development of Type I Diabetes.

DETAILS

  • Gene: FAM3D
  • Gene Id: 131177
  • Amino Acid: YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFVDHHHHHH
  • Uniprot Id: Q96BQ1
  • Product Content: Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Application Note: Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Storage Condition: Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Shipping Condition: The product is shipped on dry ice/ice packs.