sc-101595 SAMPLE sc-101595
Promo Available
Scientist.com Supplier
SBP Tag (SB19-C4)
Santa Cruz Biotechnology
DESCRIPTION
mouse monoclonal IgG1; SBP Tag Antibody (SB19-C4) is an IgG1 κ mouse monoclonal SBP Tag antibody (also designated Streptavidin-Binding Peptide antibody, SBP-Tag antibody, 38 amino acid SBP tag antibody, SBP antibody, or MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP antibody) that detects the SBP Tag protein of origin by WB and IF. SBP Tag Antibody (SB19-C4) is available as both the non-conjugated anti-SBP Tag antibody form, as well as multiple conjugated forms of anti-SBP Tag antibody, including agarose, PE, FITC and multiple Alexa Fluor® conjugates. Streptavidin, a tetrameric protein purified from Streptomyces avidinii, binds very tightly to Biotin with a Kd of 10-14 mol/l, forming one of the strongest known biological and noncovalent interactions. Each monomer of Streptavidin binds one molecule of Biotin. The strong Streptavidin-Biotin bond can be used to "glue" various chemicals onto surfaces and to link together molecules such as radioisotopes and monoclonal antibodies. Streptavidin is widely utilized in scientific laboratories, commonly for the purification of immunochemistries, and it is one of the most important components in diagnostic and laboratory kits. SBP Tag (Streptavidin binding protein Tag) is a 38 amino acid protein affinity sequence that binds to Streptavidin and can be used for the detection and purification of a variety of recombinant proteins.
DETAILS
- Host: mouse
- Type: Primary
- Clonality: Monoclonal
- Conjugate: unconjugated
- Applications: WB, IF
- Protein Target: SBP tag
- Species Reactivity: N/A
PROMOTION TERMS
Free sample available. Limit 3 free samples for each full size Santa Cruz Biotechnology primary antibody ordered. All samples must be different. Customer responsible for shipping costs.
Equivalent Items
| ... Loading