ACC-013_25 mcl ACC-013_50 mcl ACC-013_0.2 ml ACC-013-CF_0.2 ml
Scientist.com Supplier
Anti-CaV1.2a (CACNA1C) Antibody
Alomone Labs
Image
Image
Image
DESCRIPTION:
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rabbit CaV1.2a channel. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize CaV1.2a from mouse, rat and human samples.
DETAILS
- Form: Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
- Host: Rabbit
- Clone: NA
- Label: Unconjugated
- Purity: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
- Target: Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.
- Comment: Contact Alomone Labs for technical support and product customization
- Gene Id: 100101555
- Isotype: Rabbit IgG
- Homology: Rat, guinea pig - 31/46 amino acid residues identical
- Is Toxin: No
- Sequence: GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine
- Synonyms: Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.
- Accession: P15381
- Clonality: Polyclonal
- Lead Time: 1-2 Business Days
- Reactivity: Human|Rat|Mouse
- Formulation: PBS pH7.4
- Applications: IC|IF|IHC|IP|WB
- Preservative: No Preservative
- Reconstitution: 0.2 ml double distilled water (DDW).
- Blocking Peptide: BLP-CC013
- Negative Control: BLP-CC013
- Positive Control: NA
- Cited Application: IHC|ICC
- Immunogen Location: Intracellular, N-terminus
- Peptide Confirmation: Confirmed by DNA sequence and SDS-PAGE
- Shipping And Storage: Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
- Immunogen Source Species: Rabbit
- Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
- Antigen Preadsorption Control: 3 µg fusion protein per 1 µg antibody
- Applications May Also Work In: IC|IF|IHC|IP|WB
- Storage Before Reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
- Product Page Scientific Background: All L-type calcium channels are encoded by one of the CaV1 channel genes. These channels play a major role as a Ca2+ entry pathway in skeletal, cardiac and smooth muscles as well as in neurons, endocrine cells and possibly in non-excitable cells such as hematopoetic and epithelial cells. All CaV1 channels are influenced by dihydropyridines (DHP) and are also referred to as DHP receptors.While the CaV1.1 and CaV1.4 isoforms are expressed in restricted tissues (skeletal muscle and retina, respectively), the expression of CaV1.2 is ubiquitous and CaV1.3 channels are found in the heart, brain and pancreas. Several peptidyl toxins are described that are specific L-type channel blockers, but so far no selective blocker for one of the CaV1 isoforms have been described. These include the Mamba toxins Calcicludine (#SPC-650), Calciseptine (#C-500) and FS-2 (#F-700).There are two splice variants to the CaV1.2 channel designated CaV1.2a and CaV1.2b. The expression of the CaV1.2b variant is restricted to smooth muscle while CaV1.2a is specifically expressed in cardiac muscle.
- Standard Quality Control Of Each Lot: Western blot analysis
- Application Dilutions Western Blot Wb: 1:200
- Antibody Concentration After Reconstitution: 1 mg/ml
- Application Dilutions Immunohistochemistry Paraffin Embedded Sections Ihc: Contact Alomone for information