SPR-322B-A594 SPR-322C-A594 SPR-322E-A594
Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)
Stressmarq Biosciences
DESCRIPTION
Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)
DETAILS
- Nature: Recombinant
- Purity: >95%
- Target: Alpha Synuclein: ATTO 594
- Category: Protein
- Conjugate: ATTO 594
- References: 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013). 2. Zhang L., et al. (2008) Brain Res. 1244: 40-52. 3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117. 4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230. 5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840. 6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.
- Applications: WB | SDS-PAGE | In vivo assay | In vitro assay
- Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Protein Size: N/A
- Purification: Ion-exchange Purified
- Concentration: Lot/batch specific. See included datasheet.
- Protein Length: Full Length
- Research Areas: Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau | Neuroscience | Neurodegeneration | Parkinson's Disease | Synuclein | Neuroscience | Neurodegeneration | Multiple System Atrophy
- Storage Buffer: PBS pH7.4, 0.09% Azide
- Alternative Names: Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein PFF, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha synuclein protein seed, ATTO 594 conjugated alpha synuclein, ATTO labelled alpha synuclein fibrils
- Cite This Product: Human Recombinant Alpha Synuclein Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-322B-A594)
- Expression System: E. coli
- Species Full Name: Human
- Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG
- Biological Activity: Under Investigation
- Storage Temperature: -80ºC
- Shipping Temperature: Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
- Cellular Localization: Cytoplasm | Membrane | Nucleus
- Scientific Background: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
- Certificate of Analysis: Thioflavin T emission curve shows increased fluorescence (correlated to protein fibrillation) when active alpha Synuclein PFFs:ATTO-594 are combined with active alpha Synuclein monomers. Passed sterility test (OD600 equivalent to negative control (dH20) after 72 hr incubation at 37C, 200 rpm in rich medium)