DESCRIPTION

• Nature: Recombinant
• Purity: >95%
• Target: Tau (K18) Delta K280 Mutant
• Category: Protein
• Conjugate: No Tag
• References: 1. www.alz.org/alzheimers-dementia/facts-figures 2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146–148 (1907) 3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497. 4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174. 5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.
• Applications: WB | SDS-PAGE | In vivo assay | In vitro assay
• Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
• Protein Size: ~15 kDa
• Purification: Ion-exchange Purified
• Concentration: Lot/batch specific. See included datasheet.
• Protein Length: Partial
• Research Areas: Alzheimer's Disease | Axon Markers | Cell Markers | Cell Signaling | Cytoskeleton | Microtubules | MT Associated Proteins | Neurodegeneration | Neuron Markers | Neuroscience | Tangles & Tau
• Storage Buffer: PBS pH 7.4
• Alternative Names: Tau PFFs, Tau PFF, Tau protein Pre-formed Fibrils, Tau aggregates, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 4, tubulin-associated unit, MAPT DeltaK280, ΔK280 Tau, K18 delta K280 Tau, truncated ΔK280 Tau
• Cite This Product: Human Recombinant Tau Protein (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-477B)
• Expression System: E. coli
• Species Full Name: Human
• Amino Acid Sequence: MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
• Storage Temperature: -80ºC
• Shipping Temperature: Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
• Cellular Localization: Cytoplasm | Axolemma | Axolemma Plasma Membrane | Axon | Cell Body | Cell membrane | Cytoplasmic Ribonucleoprotein Granule | Cytoplasmic Side | Cytoskeleton | Cytosol | Dendrite | Growth cone | Microtubule | Microtubule Associated Complex | Neurofibrillary Tangle | Neuronal Cell Body | Nuclear Periphery | Nuclear Speck | Nucleus | Peripheral membrane protein | Plasma Membrane | Tubulin Complex
• Scientific Background: Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The ΔK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).
• Certificate of Analysis: Certified >95% pure using SDS-PAGE analysis.