DESCRIPTION

• Nature: Synthetic (TFA preparation, HFIP treated precursor)
• Purity: >95%
• Target: Amyloid Beta Pyroglutamate 3-42
• Category: Protein
• Conjugate: No Tag
• References: 1. Stine et al. 2003. JBC. 278(13):11612-22; doi: 10.1074/jbc.M210207200 2. Chromy et al. 2003. Biochemistry. 42:12749-12760; doi: 10.1021/bi030029q 3. Panza et al. 2019. Nat Rev Neurol. 15:73-88; https://doi.org/10.1038/s41582-018-0116-6 4. Valverde et al. 2021. JBC. 297:100963; https://doi.org/10.1016/j.jbc.2021.100963 5. Schilling et al. 2008. Nat Med. 14:1106-11; DOI: 10.1038/nm.1872 6. Hartlage-Rubsamen et al. 2011. Acta Neuropathol. 121:705-19; 10.1007/s00401-011-0806-2 7. Xu, Wang and Wu. 2021. J Med Chem. 64:6549–65; DOI: 10.1021/acs.jmedchem.1c00325 8. Bayer. 2021. Nat Mol Psych. 27:1880-1885; https://doi.org/10.1038/s41380-021-01409-3
• Applications: WB | In vivo Assay | In vitro Assay
• Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
• Protein Size: 4.3 kDa
• Purification: N/A
• Concentration: Lot/batch specific. See included datasheet.
• Protein Length: 40 amino acids
• Research Areas: Neuroscience | Neurodegeneration | Alzheimer's Disease | Amyloid
• Storage Buffer: 10mM HCl with 2% DMSO
• Alternative Names: pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AβPE3, APP
• Cite This Product: Human Amyloid Beta pyroglutamate 3-42 Pre-formed Fibrils (StressMarq Biosciences Inc., Victoria BC CANADA, Catalog # SPR-492)
• Expression System: N/A
• Species Full Name: Human
• Amino Acid Sequence: pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Storage Temperature: -80ºC
• Shipping Temperature: Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
• Cellular Localization: Cell Membrane | Intracellular Vesicles
• Scientific Background: Our Amyloid Beta pyroglutamate 3-42 (pyro Aβ) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). Our pyro Aβ3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody. Amyloid beta peptide (Aβ) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of Aβ plaques in the brain is considered a hallmark of Alzheimer’s disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3). Pyroglutamate Aβ 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to compromise 15-45% of total amyloid beta deposits in brains of AD patients (4,5). Pyroglutamate Aβ 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length Aβ 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8).
• Certificate of Analysis: Protein certified >95% pure by mass spec and HPLC