ARHGAP28 Rabbit Polyclonal Antibody

DESCRIPTION:

Rabbit Polyclonal Anti-ARHGAP28 Antibody

DETAILS

Host: Rabbit
Note: Immunogen Sequence Homology: Human: 100%
Status: 5 Days*
Gene Id: 79822
Isotype: IgG
Storage: Store at -20°C as received.
Category: Antibodies
Synonyms: DKFZp686A2038; FLJ10312; Rho GTPase activating protein 28
Clonality: Polyclonal
Gene Name: Rho GTPase activating protein 28
Immunogen: The immunogen for Anti-ARHGAP28 Antibody: synthetic peptide directed towards the C terminal of human ARHGAP28. Synthetic peptide located within the following region: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD
Stability: Stable for 12 months from date of receipt.
Background: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Uniprot Id: NP_109597 Entrez Gene 79822 Human
Conjugation: Unconjugated
Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Gene Symbol: ARHGAP28
Applications: WB
Availability: 5 Days
Purification: Affinity Purified
Reactivities: Human
Database Link: NP_109597 Entrez Gene 79822 Human
Accession Number: NP_109597
Recommended Dilution: WB
Predicted Protein Size: 62 kDa