BLP-PC062
Scientist.com Supplier
KCNH2/HERG Blocking Peptide
Alomone Labs
DESCRIPTION
KCNH2/HERG Blocking Peptide (#BLP-PC062) is the original antigen used for immunization during Anti-KCNH2 (HERG) Antibody (#APC-062) generation. The blocking peptide binds and ‘blocks’ Anti-KCNH2/HERG primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control. KCNH2/HERG Blocking Peptide (#BLP-PC062) is the original antigen used for immunization during Anti-KCNH2 (HERG) Antibody (#APC-062) generation. The blocking peptide binds and 'blocks' Anti-KCNH2/HERG primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
DETAILS
- Form: Lyophilized powder
- Type: GST fusion protein
- Purity: >95% (SDS-PAGE)
- Target: KCNH2
- Comment: Contact Alomone Labs for technical support and product customization
- Gene Id: 3757
- Sequence: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
- Accession: Q12809
- Lead Time: 1-2 Business Days
- Formulation: Lyophilized Powder.
- Product Group: Blocking Peptide
- Reconstitution: 100 μl PBS
- Antibody Gene Id: 3757
- Peptide Confirmation: Confirmed by DNA sequence and SDS-PAGE
- Shipping and Storage: Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
- Storage After Reconstitution: -20°C.
- Antigen Preadsorption Control: 3 µg fusion protein per 1 µg antibody
- Applications May Also Work In: WB|IHC
- Storage Before Reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C
- Concentration After Reconstitution: 1.2 mg/ml.
- Standard Quality Control of Each Lot: Western blot analysis.
- Product Page Antibodies Part of Immunogen: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)