Skip to Main Content
More Intelligent Procurement, Faster R&D

Go to Main Navigation

BLP-PC062

Scientist.com Supplier

KCNH2/HERG Blocking Peptide

Alomone Labs

DESCRIPTION

KCNH2/HERG Blocking Peptide (#BLP-PC062) is the original antigen used for immunization during Anti-KCNH2 (HERG) Antibody (#APC-062) generation. The blocking peptide binds and ‘blocks’ Anti-KCNH2/HERG primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control. KCNH2/HERG Blocking Peptide (#BLP-PC062) is the original antigen used for immunization during Anti-KCNH2 (HERG) Antibody (#APC-062) generation. The blocking peptide binds and 'blocks' Anti-KCNH2/HERG primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

DETAILS

  • Form: Lyophilized powder
  • Type: GST fusion protein
  • Purity: >95% (SDS-PAGE)
  • Target: KCNH2
  • Comment: Contact Alomone Labs for technical support and product customization
  • Gene Id: 3757
  • Sequence: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
  • Accession: Q12809
  • Lead Time: 1-2 Business Days
  • Formulation: Lyophilized Powder.
  • Product Group: Blocking Peptide
  • Reconstitution: 100 μl PBS
  • Antibody Gene Id: 3757
  • Peptide Confirmation: Confirmed by DNA sequence and SDS-PAGE
  • Shipping and Storage: Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
  • Storage After Reconstitution: -20°C.
  • Antigen Preadsorption Control: 3 µg fusion protein per 1 µg antibody
  • Applications May Also Work In: WB|IHC
  • Storage Before Reconstitution: Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C
  • Concentration After Reconstitution: 1.2 mg/ml.
  • Standard Quality Control of Each Lot: Western blot analysis.
  • Product Page Antibodies Part of Immunogen: GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)