Skip to Main Content
More Intelligent Procurement, Faster R&D

Go to Main Navigation

HPA029615

Scientist.com Supplier

Anti-DTNBP1

Atlas Antibodies

DESCRIPTION

Polyclonal Antibody against Human DTNBP1, Gene description: dystrobrevin binding protein 1, Alternative Gene Names: BLOC1S8, DBND, Dysbindin, HPS7, My031, Validated applications: ICC, IHC, WB, Uniprot ID: Q96EV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DETAILS

  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
  • Htscode: 3002150000
  • Isotype: IgG
  • Genename: DTNBP1
  • Sequence: GLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKK
  • Clonality: Polyclonal
  • Uniprotid: Q96EV8
  • Hostspecies: RABBIT
  • Releasedate: 2010-03-25
  • Entrezgeneid: 84062
  • Genedescription: dystrobrevin binding protein 1
  • Speciesreactivity: Human
  • Enhancedvalidation: Yes
  • Alternativegenenames: BLOC1S8, DBND, Dysbindin, HPS7, My031
  • Validatedapplications: IHC, ICC, WB
  • Interspeciesreactivity: ENSMUSG00000057531: 92%, ENSRNOG00000048719: 90%
  • Nextbatchconcentration: 0.05
  • Validationstrategylist: RECOMBINANT_EXPRESSION, STANDARD