32-8464-10 32-8464
Recombinant Human IL-1 Receptor-Like 1/IL-1RL1/ST2 (C-6His)
Abeomics
Image
DESCRIPTION
Source: Human Cells.
MW :36kD.
Recombinant Human Interleukin-1 receptor-like 1 is produced by our Mammalian expression system and the target gene encoding Lys19-Phe328 is expressed with a 6His tag at the C-terminus. Interleukin 1 receptor-like 1(IL1RL1) is a member of the interleukin-1 receptor family, Contains 3 Ig-like C2-type domains and 1 TIR domain. It is highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. IL1RL1 is a receptor for interleukin-33, its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL1RL1 may possibly be involved in helper T-cell function. Soluble IL1RL1 also acts as a negative regulator of Th2 cytokine production, it directly implicated in the progression of cardiac disease.
DETAILS
- Gene: IL1RL1
- Gene Id: 9173
- Amino Acid: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECFVDHHHHHH
- Uniprot Id: Q01638
- Product Content: Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
- Application Note: Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
- Storage Condition: Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
- Shipping Condition: The product is shipped at ambient temperature.