SPR-320A SPR-320B SPR-320C
BVR Protein
Stressmarq Biosciences
DESCRIPTION
Rat Natural BVR Full Length Protein
DETAILS
- Nature: Natural
- Purity: >90%
- Target: BVR
- Category: Protein
- Conjugate: No tag
- References: 1. Singleton J.W., Laster L. (1965). J Biol Chem. 240: 4780-4789. 2. Kutty R.K., Maines M.D. (1981) J Biol Chem. 256: 3956-3962. 3. Mishra M., Ndisand J.F. (2014) Curr Pharm Des. 20(9): 1370-1391.
- Applications: WB | SDS-PAGE
- Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Protein Size: ~36 kDa
- Purification: Ion-exchange Purified
- Concentration: Lot/batch specific. See included datasheet.
- Protein Length: Full Length
- Research Areas: Cancer | Oxidative Stress
- Storage Buffer: 10mM Tris pH7.5, 0.1mM EDTA, 0.2mM DTT, 20% glycerol
- Alternative Names: Biliverdin Reductase Protein, Biliverdin IX alpha reductase Protein, Biliverdin reductase A Protein, Biliverdin-IX alpha-reductase Protein, BLVR A Protein, BLVR Protein, Blvra Protein, BVR A Protein, BVRA Protein, Zinc metalloProtein, zinc-metalloprotein Protein
- Cite This Product: Rat Natural BVR Protein (StressMarq Biosciences, Canada, Cat # SPR-320A)
- Expression System: Native
- Species Full Name: Rat
- Amino Acid Sequence: MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQKK
- Storage Temperature: -80ºC
- Shipping Temperature: Blue Ice or 4ºC
- Cellular Localization: Cytoplasm
- Scientific Background: Biliverdin Reductase (BVR) is a cytoplasmic enzyme that catalyzes the conversion of biliverdin to bilirubin by converting a double bond between the second and third pyrrole ring into a single bond (1). It is ubiqutiously expressed in all tissues- it occurs in cells and brain regiuons that already display HO-1 and HO-2, but also in regions and cell types with potential to induce stress proteins. It is unique among all enzymes in having two pH optima, using a different cofactor at each pH range, NADH at pH7.0 and NADPH at pH8.7 (2). It is not inactivated by heat shock, and have shown to abate inflammation, oxidative stress and apoptosis (3).
- Certificate of Analysis: This product has been certified >90% pure using SDSPAGE analysis.