Skip to Main Content
More Intelligent Procurement, Faster R&D

Go to Main Navigation

80109

Scientist.com Supplier

HCV1b (R155K), FLAG-His-tags Recombinant

BPS Bioscience

DESCRIPTION

Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b (GenBank Accession No. AF054247) with Arg-to-Lys mutation on a.a. 155, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.3 kDa, expressed in an E. coli expression system.

DETAILS

  • Aa: 21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3
  • Mw: 22.3 kDa
  • Tags: N-terminal FLAG-His-tags
  • Format: Aqueous buffer solution
  • Genbank: AF054247
  • Species: Human
  • Uniprot: O92972
  • Shiptemp: -80°C (dry ice)
  • Synonyms: hepatitis c virus genotype 1b K155
  • Warnings: Avoid freeze/thaw cycles.
  • Category: Protease/Protein
  • References: 1. Lin, C., et al., Hepatitis C Viruse. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6. 2. Lang Kuhs, K.A., et al., Mol. Ther. 2012 May;20(3):669-678. 3. Massariol, MJ., et al., Biochem Biophys Res Commun. 2010 Jan 1;391(1):692-697.
  • Description: Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1b (GenBank Accession No. AF054247) with Arg-to-Lys mutation on a.a. 155, an N-terminal FLAG-His tag, and a 4 a.a. linker, MW = 22.3 kDa, expressed in an E. coli expression system.
  • Formulation: 40 mM Tris-HCl, pH 8.0, 400 mM NaCl, 0.2% Triton X-100, 10 mM beta-mercaptoethanol, 100 µg/mL FLAG peptide, and 30% glycerol.
  • Unspsc Code: 12352202
  • Unspsc Name: Proteins
  • Applications: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. 
  • Product Type: Protein
  • Biosafety Level: Not applicable (BSL-1)
  • Assay Conditions: Assay was performed in 100 μl HCV assay buffer containing 50 mM Tris, pH 7.4, 150 mM NaCl, 5 mM DTT, 10% glycerol, and 5 ?M fluorescently labeled HCV substrate peptide. Reaction was monitored at room temperature for 20 min. continuously at ex350/em500.
  • Specific Activity: ≥ 12 pmole/min/µg
  • Storage Stability: At least 6 months at -80°C.
  • Amino Acid Sequence: MDYKDDDDKHHHHHHGSVVIVGRIILSGSGSITAYSQQTRGVLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDLDLVGWQAPPGARSMTPCSCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGVFKAAVCTRGVAKAVDFIPVESMETTMRS
  • Scientific Category: Protease