Skip to Main Content
More Intelligent Procurement, Faster R&D

Go to Main Navigation

HPA003176

Scientist.com Supplier

Anti-ETS2

Atlas Antibodies

DESCRIPTION:
Polyclonal Antibody against Human ETS2, Gene description: v-ets avian erythroblastosis virus E26 oncogene homolog 2, Validated applications: ICC, Uniprot ID: P15036, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DETAILS

  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
  • Htscode: 3002150000
  • Isotype: IgG
  • Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
  • Genename: ETS2
  • Sequence: IKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLE
  • Clonality: Polyclonal
  • Uniprotid: P15036
  • Hostspecies: RABBIT
  • Entrezgeneid: 2114
  • Genedescription: v-ets avian erythroblastosis virus E26 oncogene homolog 2
  • Speciesreactivity: Human
  • Enhancedvalidation: No
  • Validatedapplications: ChIP, ICC
  • Interspeciesreactivity: ENSMUSG00000022895: 94%, ENSRNOG00000001647: 94%
  • Validationstrategylist: STANDARD