SPR-310A SPR-310B
Scientist.com Supplier
Cpn10 Protein
Stressmarq Biosciences
DESCRIPTION
Human Recombinant Cpn10 Protein
DETAILS
- Nature: Recombinant
- Purity: >90%
- Target: Cpn10
- Category: Protein
- Conjugate: No tag
- References: 1. Velez-Granell C.S., et al. (1994) J of Cell Science. 107(3):539-549. 2. Morton H., Hegh V., and Clunie G.J.A. (1974) Nature (London) 249: 459-460. 3. Cavanagh A.C., and Morton H. (1994) Eur. J. Biochem. 222: 551-560. 4. Minto M., et al. (1998) Molecular Cell Research. 1403 (2): 151-157.
- Applications: WB | SDS-PAGE
- Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Protein Size: ~10 kDa
- Purification: Multi-Step Purified
- Concentration: Lot/batch specific. See included datasheet.
- Research Areas: Cancer | Heat Shock
- Storage Buffer: 20mM Tris, pH7.5, 0.3M NaCl, 10% glycerol, 1 mM DTT
- Alternative Names: 10kDa Chaperonin Protein, Chaperonin 10 Protein, Cpn 10 Protein, EPF Protein, GROES Protein, Heat Shock 10kD protein1 Protein, HSP10 Protein, HSPE1 Protein
- Cite This Product: Human Recombinant Cpn10 Protein (StressMarq Biosciences, Canada, Cat # SPR-310A)
- Expression System: E. coli
- Species Full Name: Human
- Amino Acid Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
- Storage Temperature: -20ºC
- Shipping Temperature: Blue Ice or 4ºC
- Cellular Localization: Mitochondrion Matrix
- Scientific Background: Chaperonin 10, otherwise known as Cpn10, (groES in E.coli) make up a family of small heart shock proteins with an approximate molecular mass of 10kDa (HSP10s). Cpn10 acts as a co-chaperone and interacts with the HSP60 family to promote proper folding of polypeptides. Cpn10 and Cpn60 both exhibit sevenfold axis of symmetry and function as a team in the protein folding and assembly process (1). Cpn10 has been located in human platelets, but is also present in human maternal serum (2, 3). It has been reported that human Cpn10 is identical with early pregnancy factor, which is involved in control over cell growth and development. This identification suggest that Cpn10 may act like a hormone in stressful situations such as pregnancy (4).
- Certificate of Analysis: This product has been certified >90% pure using SDS-PAGE analysis.
Equivalent Items
| ... Loading