Anti-SMARCA5

DESCRIPTION

Polyclonal Antibody against Human SMARCA5, Gene description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5, Alternative Gene Names: hISWI, hSNF2H, ISWI, Validated applications: ICC, IHC, WB, Uniprot ID: O60264, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DETAILS

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Htscode: 3002150000
Isotype: IgG
Genename: SMARCA5
Sequence: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA
Clonality: Polyclonal
Uniprotid: O60264
Hostspecies: RABBIT
Releasedate: 2008-08-18
Entrezgeneid: 8467
Genedescription: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Speciesreactivity: Human, Mouse, Rat
Enhancedvalidation: Yes
Publicationdoicount: 3
Alternativegenenames: hISWI, hSNF2H, ISWI
Validatedapplications: ICC, IHC, WB
Interspeciesreactivity: ENSRNOG00000018149: 46%, ENSMUSG00000031715: 82%
Nextbatchconcentration: 0.2
Validationstrategylist: GENETIC, STANDARD