Recombinant Human Interferon a2A Variant (Lys46)/IFN-a2A

DESCRIPTION

Source: E.coli. MW :19.24kD. Recombinant Human Interferon alpha-2a is produced by our E.coli expression system and the target gene encoding Cys24-Glu188 is expressed. At least 23 different variants of IFN-a are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-a subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-a subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.

DETAILS

Gene: IFNA2
Gene Id: 3440
Amino Acid: MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Uniprot Id: P01563
Product Content: Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Application Note: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. Biological Activity : Specific Activity is greater than 1.0 x 10^8 IU/ mg.
Storage Condition: Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Shipping Condition: The product is shipped at ambient temperature.