DESCRIPTION

• Mw: 3157 Da
• Form: Lyophilized
• Cas No: 119418-04-1
• Purity: ≥98% (HPLC)
• Source: Synthetic peptide
• Target: Galanin receptors
• Comment: Contact Alomone Labs for technical support and product customization
• Gene Id: GALR1, GALR2, GALR3
• Activity: Galanin receptor agonist1.
• Is Toxin: No
• Sequence: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-OH
• Accession: P22466
• Lead Time: 1-2 Business Days
• Solubility: Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
• Formulation: Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
• Bioassay Tested: yes
• Molecular Formula: C139H210N42O43
• Storage of Solutions: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
• Steril Endotoxin Free: no
• Effective Concentration: 1 - 10 nM
• Storage After Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
• Reconstitution and Solubility: Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
• Storage Before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
• Product Page - Scientific Background: Galanin is a peptide hormone that acts as a non-selective and potent galanin receptor agonist. In human, Galanin is a C-terminal-amidated 30-residue peptide deriving its name from the N-terminal glycine and C-terminal alanine residue1,2. Galanin receptors belong to the family of G-protein coupled receptors and consist of three subtypes: GalR1, GalR2, and GalR3.Galanin is widely distributed through the central and peripheral nervous system and its biological activity includes contraction or relaxation of gut smooth muscles, inhibition of insulin and somatostatin release, and modulation of hormone secretion from the pituitary and adrenal glands. It is believed that galanin plays an important role as a neuromodulator of endocrine secretion and synaptic transmission1. Additional studies show that galanin and its receptors are involved in the transmission and modulation of nociception of the central nervous system, at spinal cord levels and in the brain2.