GH-160
Scientist.com Supplier
GIP (1-39)
Isca Biochemicals
DESCRIPTION:
GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP (1-39) is more potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP and loss of the incretin effect is an early characteristic of type 2 diabetes
DETAILS
- Mf: C210H316N56O61S
- Mw: 4633.2
- Sds: GIP (1-39) MSDS_602c0541423e4.pdf
- Refs: Xie et al (2004) GIP1-39, a novel Insulinotropic peptide form and aspects on its mechanism of action. Regul.Peptides 121 107 C PMID: 15256280Ji et al (2016) Neuroprotective effects of glucose-dependent insulinotropic polypeptide in Alzheimer€™s disease. Rev. Neurosci. 27(1) 61 PMID: 26351802Hansen et al (2016) N€terminally and C€terminally truncated forms of glucose€dependent insulinotropic polypeptide are high€affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. 173 826 PMID: 26572091Related areas All peptides >All glucagon and related receptor modulators >All endocrinology research categories >All diabetes research categories >
- Cas No: 725474-97-5
- Purity: >95% By HPLC
- Target: Glucagon and related receptors
- Storage: Store dark, dry and frozen
- Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
- Appearance: Freeze dried solid
- Solubility: Soluble to 10 mg per ml in water
- Producttype: Peptides
- Modifications: None
- Threelettersequence: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH