Skip to Main Content
Welcome to the Scientist.com Marketplace

Go to Main Navigation

80010

HCV1a, FLAG-His-tags Recombinant

BPS Bioscience

DESCRIPTION

Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1a (HCV1a), GenBank Accession No. NC_004102, with N-terminal FLAG-His tag, MW = 22.4 kDa, expressed in an E. coli expression system.

DETAILS

  • Aa: 21-32 of NS4A, linker (4 a.a.) and a.a. 3-181 of NS3
  • Mw: 22.4 kDa
  • Tags: N-terminal FLAG-His-tags
  • Format: Aqueous buffer solution
  • Genbank: NC_004102
  • Species: Human
  • Uniprot: P27958
  • Shiptemp: -80°C (dry ice)
  • Synonyms: hepatitis c virus genotype 1a
  • Warnings: Avoid freeze/thaw cycles.
  • Category: Protease/Protein
  • References: 1. Lin, C., et al., Hepatitis C Virus. Norfolk (UK): Horizon Bioscience; 2006. Chapter 6. 2. Prabhu, R., et al., Exp Mol Pathol. 2004 Jun;76(3):242-52.
  • Description: Fusion protein corresponding to the serine protease NS3 (a.a. 3-181) and cofactor NS4A (a.a. 21-32) from Hepatitis C virus genotype 1a (HCV1a), GenBank Accession No. NC_004102, with N-terminal FLAG-His tag, MW = 22.4 kDa, expressed in an E. coli expression system.
  • Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 20% glycerol, and 250 mM imidazole.
  • Unspsc Code: 12352202
  • Unspsc Name: Proteins
  • Applications: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. 
  • Product Type: Protein
  • Biosafety Level: Not applicable (BSL-1)
  • Related Products: 80103, 80101, 80102
  • Storage Stability: At least 6 months at -80°C.
  • Amino Acid Sequence: MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVE GEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQ GSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAG HAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
  • Scientific Category: Protease